SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W4RID7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4RID7
Domain Number - Region: 55-146
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0068
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4RID7
Sequence length 196
Comment (tr|W4RID7|W4RID7_9BACI) Flagellar hook-associated protein FliD {ECO:0000313|EMBL:GAE44046.1} KW=Complete proteome OX=1294265 OS=Bacillus boroniphilus JCM 21738. GN=JCM21738_725 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKKINDSELGIRAFYDSTADKVVMERTVTGDFNKDPHTFLGAEIGYNGTNAGFIANVLQM
KAGAESPAGSGVWKTTETGGTNAKFTYNSSLTVEPPTNEYKINNIQFNFKQVTAGEETVT
VGNNTNAAFDSIVKFVNKYNEMIEKINGKLDEKRYRDYQPLSDDEKEVMEEKQIELWEEK
AKSGLIRNDSTIQWIE
Download sequence
Identical sequences W4RID7
WP_052019546.1.43688 WP_052019546.1.86257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]