SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4TV17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4TV17
Domain Number - Region: 6-27
Classification Level Classification E-value
Superfamily EF2458-like 0.0432
Family EF2458-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4TV17
Sequence length 42
Comment (tr|W4TV17|W4TV17_CUTAC) Integral membrane protein TerC {ECO:0000313|EMBL:GAE72576.1} KW=Complete proteome; Reference proteome OX=1302242 OS=Propionibacterium acnes JCM 18916. GN=JCM18916_2022 OC=Cutibacterium.
Sequence
MHHYGLDQAWFGFSSEVSIGVSLGVIAVTLALTTVASLIKKS
Download sequence
Identical sequences W4TV17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]