SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4V1M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4V1M7
Domain Number - Region: 63-106
Classification Level Classification E-value
Superfamily YonK-like 0.00641
Family Yonk-like 0.0048
Further Details:      
 
Domain Number - Region: 153-219
Classification Level Classification E-value
Superfamily Ava3019-like 0.0915
Family Ava3019-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4V1M7
Sequence length 238
Comment (tr|W4V1M7|W4V1M7_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:GAE87380.1} KW=Complete proteome; Reference proteome OX=1294263 OS=[Clostridium] straminisolvens JCM 21531. GN=JCM21531_743 OC=Ruminiclostridium.
Sequence
MEYIEKDAKDLAKYGLDSPSYVVEAAAGSQRVTLLIGDVKENNSESYGMFEGTNEVFVIN
PGALGFLDTPALEIMDGIIYAPYIYTVKDIDFNIDGKTIKIKIEEVKDETKTDETEEKDD
EVDKKYKHYIDGIDVEDRKGEEGISKFRDFYASVIGIMASAIEPEASPAGDAEISIIFNL
DTEPGKVTVEFVPRDEKTYYAMKNGKYTGIVVRKDAFDAEDGPRKTYEKFMTFLNGGQ
Download sequence
Identical sequences W4V1M7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]