SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W4VPH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4VPH9
Domain Number - Region: 13-83
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz alpha-1 subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4VPH9
Sequence length 161
Comment (tr|W4VPH9|W4VPH9_9BACI) Hypothetical cytosolic protein {ECO:0000313|EMBL:GAE94748.1} KW=Complete proteome; Reference proteome OX=1298598 OS=Gracilibacillus boraciitolerans JCM 21714. GN=JCM21714_3936 OC=Gracilibacillus.
Sequence
MAMINDDLFGKLEYKNNFWRGKTTIRMFDLDEEILLSVDAHEKADFSNVQREAFINFIQD
MKNIINEAEKQVYDYYNENYEEYREMLGNESEADKFAPKIDSISDLKRIVKPVELIVRRV
RKNGKRRLGLLCDVSWDIDNGLGIKIEDEMVEEVGYQDIVL
Download sequence
Identical sequences W4VPH9
WP_035725421.1.20002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]