SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W4Z9J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4Z9J4
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-26
Family Capz beta-1 subunit 0.0000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4Z9J4
Sequence length 79
Comment (tr|W4Z9J4|W4Z9J4_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_024819-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
VPELCEDLLSSVDQPLKIARDREQGKDYLLCEYNRDADSYRSPWSNTYNPPLESGAIPSD
NVRKLEVEANLAFDQYREL
Download sequence
Identical sequences W4Z9J4
7668.XP_782267 SPU_024819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]