SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5KMY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5KMY7
Domain Number 1 Region: 3-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.05e-96
Family Capz beta-1 subunit 0.00000000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5KMY7
Sequence length 273
Comment (tr|W5KMY7|W5KMY7_ASTMX) Capping protein (actin filament) muscle Z-line, beta {ECO:0000313|Ensembl:ENSAMXP00000008949} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYEPPIDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVSESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTLADKSKQDALRNDLVGALNKRKQQS
Download sequence
Identical sequences W5KMY7
XP_007256762.1.101067 ENSAMXP00000008949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]