SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5MLC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MLC2
Domain Number 1 Region: 9-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.24e-60
Family Capz beta-1 subunit 0.0000000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5MLC2
Sequence length 274
Comment (tr|W5MLC2|W5MLC2_LEPOC) Capping protein (actin filament) muscle Z-line, beta {ECO:0000313|Ensembl:ENSLOCP00000009181} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
LLCVCPLQSDQQLDCALDLMRRLPPQQIEKNLSDLIDLKQGVCAEREALTCGVSVCEGWG
EEAIPCEPPSDSWEFASPPLFPCDFSLFAVPSHWLGGALSFSQPVSLCRTLMYFEGGVSS
VYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQ
TTKTGSGTMNLGGSLTRQMEKDETVSESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKD
IVNGLRSVQTLADKSKQEALKNDLMEALKRKQQS
Download sequence
Identical sequences W5MLC2
ENSLOCP00000009181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]