SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5SX06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W5SX06
Domain Number - Region: 271-361
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz beta-1 subunit 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5SX06
Sequence length 530
Comment (tr|W5SX06|W5SX06_9SPIR) Uncharacterized protein {ECO:0000313|EMBL:AHH11238.1} OX=1313292 OS=Borrelia coriaceae Co53. GN=BCO_0122100 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
Sequence
MEYKITRTNSLTKKTTNFNSNNTKDQIKSILKSLVELNKDKTSADTKFIRVSQVKYQINR
MLRRKLRLYKIYWIIDIKNAKYRKSCGVEEYSARDIYNVVIKMLKNDGQKTVCKRTIERD
IKLLNEMGLLESKIIRFGENKGSMSFYKQNMQLAHLHKDITFKYLLHLLKTSLSDKKIVG
NFDDSLEESNFNYTNLKKFGILSEIDEMNKKSVMSHRVDPHAFNNKANISNNKNSKELLF
KNTDSSKPKKEECRFKRNDVETRLTCEHKISKNYLKQIKEHSNNDATYINALINLETAID
EYQSEYYIEDILEHFLKQFGNRYKYKIWMMMRRSDGVISDYDLIWEGRFRDWYPNKYKSN
CAVKETYGDNLRIGIKKASVIKEKKAKEQLNVEELKEKEIEKEKEREEERKREADRLQKY
LTGLFEREAKEREERLRKAREEELNLKKKARESMLATLEKSKERCVGLDISNNGMDKMID
ASSNEDAMVKFAIRDEFGGFKTTKGLSMVNLGIMIEDMGQNDNLKEKESK
Download sequence
Identical sequences W5SX06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]