SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W6MK95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W6MK95
Domain Number 1 Region: 6-241
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-70
Family Capz beta-1 subunit 0.000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W6MK95
Sequence length 250
Comment (tr|W6MK95|W6MK95_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:CDK25037.1} KW=Complete proteome; Reference proteome OX=1382522 OS=Kuraishia capsulata CBS 1993. GN=KUCA_T00001004001 OC=Kuraishia.
Sequence
MHPLTSSEDLLSSVDKPLKVQRCQETGKNYLTCDYNRDGDSFRSPWSNKYYPSIEDEAEA
PHPSKVLRQLEQYANDSFDIYRDLYYEGGISSVYLWDQDTDVDESGSVEFAGVVLLKKEI
DANTKDAGSWDSIHVFEVVPGSGKSAAYKITSTVILDLSTEDNSDNSIYLSGNLTRQTEK
SQTYTDSNSHISSIGSMVEEIESKLRNMLQEVYFGKTRDILGDLRSTQDIEVTKSERNRQ
QEVVKGIQGL
Download sequence
Identical sequences W6MK95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]