SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W6V1D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W6V1D4
Domain Number - Region: 33-98
Classification Level Classification E-value
Superfamily Vanabin-like 0.0248
Family Vanabin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W6V1D4
Sequence length 103
Comment (tr|W6V1D4|W6V1D4_ECHGR) Uncharacterized protein {ECO:0000313|EMBL:EUB64732.1} KW=Complete proteome; Reference proteome OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EGR_00001 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MKRLYQIKGMGDLEVTSGGTIIKLADSLQSLQRVCCVVCGLLPPPLYNQCKVQGWNILCI
TTLHGCIGCYLQKTGILPIPHFRSACYQEVEQQRICSTLLEGT
Download sequence
Identical sequences W6V1D4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]