SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W6YYU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W6YYU8
Domain Number 1 Region: 57-317
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-84
Family Capz beta-1 subunit 0.0000000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W6YYU8
Sequence length 320
Comment (tr|W6YYU8|W6YYU8_COCCA) Uncharacterized protein {ECO:0000313|EMBL:EUC36636.1} KW=Complete proteome; Reference proteome OX=930089 OS=Bipolaris zeicola 26-R-13. GN=COCCADRAFT_33988 OC=Pleosporaceae; Bipolaris.
Sequence
MSYPGGDAHDSREQRPIQAAESPGLETYEGAGIRRQYSSNPPLTSPAFFLAKHRKMADPI
DSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLCCDYNR
DGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYLWDMDD
GFAGCVLLKKSVNPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSEALGGLD
LSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDLRSLQS
LSQANKDRATQREMINSMGR
Download sequence
Identical sequences W6YYU8
XP_007709038.1.9443 jgi|Cocca1|33988|fgenesh1_pm.22_#_25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]