SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7AYS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7AYS7
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily LysM domain 0.00000000000196
Family LysM domain 0.0047
Further Details:      
 
Domain Number 2 Region: 247-290
Classification Level Classification E-value
Superfamily LysM domain 0.00000000000275
Family LysM domain 0.0045
Further Details:      
 
Domain Number 3 Region: 311-354
Classification Level Classification E-value
Superfamily LysM domain 0.00000000000536
Family LysM domain 0.0053
Further Details:      
 
Weak hits

Sequence:  W7AYS7
Domain Number - Region: 87-188
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7AYS7
Sequence length 355
Comment (tr|W7AYS7|W7AYS7_9LIST) Autolysin {ECO:0000313|EMBL:EUJ18375.1} KW=Complete proteome; Reference proteome OX=1265818 OS=Listeria aquatica FSL S10-1188. GN=MAQA_09114 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MRSTATVQGFIDQISGSASQIASQNDLYASVMMAQAILESAYGTSMLGSVPNYNLFGIKG
SYNGQSVLKQTMEDDGKGNLYPVNAYFRKYPSYHQSLEDYARVIKGGPSWNPNYYAGAWK
SNTASYLDATKALTGTYATDTSYSVKLNNLIKTYNLTQFDTPGSGNNAGSSADVYYTVKK
GDTLWRIATRHSVSVAALKSMNNLKSDTIYVNQKLIVKKGTVVAPPTSGGINPGNSNTGG
GSSAPAKTYKVSAGDTLWRISNKFGVSVANLKSWNGLKSDVIHVGQVLKVSSSTNGNVST
PKPGNNSSQASYYTVKKGDTLWSLASKNKTSVAKIKSLNKLSSNTIYVGQKLRVK
Download sequence
Identical sequences W7AYS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]