SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7B335 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7B335
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-79
Family Capz alpha-1 subunit 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7B335
Sequence length 307
Comment (tr|W7B335|W7B335_PLAVN) Uncharacterized protein {ECO:0000313|EMBL:EUD72246.1} KW=Complete proteome OX=138298 OS=Plasmodium vinckei petteri. GN=YYG_02145 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDSLLNEKKKFIRHVLSNAPPGKISDLISNLKIIFGSNAIIQNFIEDIISNYNEDNHILI
PFENNEYIIICKQSKNGNVYLHPNLKILANVNHLKRKVIDTTPLTKFDYSDILEKYRQAC
NNKLKEYVDIYYKKWSEHQTENYPTVNIGSKHGLNVKCASSVYASESENKNNLFLIICCD
RYYLKNFHASSWRSSWNVNFLETDQEIPLTGTIDVVLTYFEDANINFKTRKVFEKRVSVT
NDVESFASSILSVIRECENDVLYDLNHFIANTSNDLIKNTRKIIPLNGDKFYWMETYQDI
PTQIKLI
Download sequence
Identical sequences W7B335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]