SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7B3A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7B3A5
Domain Number 1 Region: 7-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-55
Family Capz beta-1 subunit 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7B3A5
Sequence length 306
Comment (tr|W7B3A5|W7B3A5_PLAVN) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:EUD72351.1} KW=Complete proteome OX=138298 OS=Plasmodium vinckei petteri. GN=YYG_02252 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MEDTRNSEGKIDAVLNICNILPARLFEETIIILSKIDKNLTNNILINKEGPIKIKFDNKE
KKYFLGNMFNKEKESYRSPYTNLYYPENFPNSYIPSEPLRSLEILYNEIFERYRKAYYIN
GLSSVYLWPNPIEDGFVACFMIKKKENYSNNTYMDWEGTHLIQVNITHSIIHYQISTTLN
ISIVQKNETILSASVNKVLENPKKISDINLIKDKFFHIENMGKIIEGIENSLRKSIEYIY
LSKINENLNSLRYNDLLYNNKNYHKIKNLESISSDIKCSKGNIQNELKSKLKKKNLNGGT
EYLLNT
Download sequence
Identical sequences W7B3A5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]