SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7CDP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W7CDP3
Domain Number - Region: 24-67
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz beta-1 subunit 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7CDP3
Sequence length 86
Comment (tr|W7CDP3|W7CDP3_BROTH) Uncharacterized protein {ECO:0000313|EMBL:EUJ37454.1} KW=Complete proteome; Reference proteome OX=1121126 OS=Brochothrix thermosphacta DSM 20171 = FSL F6-1036. GN=BFR34_09340 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Brochothrix.
Sequence
MVTKSNIKTAIVLTILLTVICYTLIPLAMSHYLREQLVMDKDKAVVSNYNANNDSLFYDY
TSELFLTALTQKNKDNTLNLTTADAR
Download sequence
Identical sequences W7CDP3
WP_029090583.1.100498 WP_029090583.1.86728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]