SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7DBP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W7DBP8
Domain Number - Region: 4-77
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz beta-1 subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7DBP8
Sequence length 98
Comment (tr|W7DBP8|W7DBP8_9LIST) Gp6 protein {ECO:0000313|EMBL:EUJ46672.1} KW=Complete proteome OX=1265846 OS=Listeria rocourtiae FSL F6-920. GN=PROCOU_11173 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MTVSDELLQEVKDYLRITWDDTTEDKRLKNIINRVGAYMERVTGTSFTFVEEDEAKQLLF
DGTRYAHNNAFEYFQENFLGQIQSLQFKVAVADAESQP
Download sequence
Identical sequences W7DBP8
WP_036071976.1.42212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]