SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7DH89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W7DH89
Domain Number - Region: 80-141
Classification Level Classification E-value
Superfamily PG1388-like 0.0654
Family PG1388-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7DH89
Sequence length 146
Comment (tr|W7DH89|W7DH89_9LIST) Uncharacterized protein {ECO:0000313|EMBL:EUJ49427.1} KW=Complete proteome OX=1265822 OS=Listeria fleischmannii FSL S10-1203. GN=MCOL2_16087 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MKNFFVRHSNLTLNYEYFYNVLDQETISLDSLMNSIEKLQVMIVNLNSPNDDPQLIFESL
NSTGVDLKDGDKIRNYLLMNELPDAQVAYFKNYWEPIEERTNFDLSSFFRDYLTVKTYKY
PNISKVYETFIEFYSFKYNDKMSFFD
Download sequence
Identical sequences W7DH89
WP_036064493.1.4301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]