SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7ELE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7ELE2
Domain Number 1 Region: 57-317
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-84
Family Capz beta-1 subunit 0.0000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7ELE2
Sequence length 320
Comment (tr|W7ELE2|W7ELE2_COCVI) Uncharacterized protein {ECO:0000313|EMBL:EUN26740.1} KW=Complete proteome OX=930091 OS=Bipolaris victoriae FI3. GN=COCVIDRAFT_99963 OC=Pleosporaceae; Bipolaris.
Sequence
MSYPGGDAHDSREQRPIQAAESPGLETYEGAGTRRQYSSNPPLTSPAFFLAKHRKMADPI
DSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLCCDYNR
DGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYLWDMDD
GFAGCVLLKKSVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSEALGGLD
LSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDLRSLQS
LSQANKDRATQREMINSMGR
Download sequence
Identical sequences W7ELE2
XP_014556327.1.39273 jgi|Cocvi1|99963|e_gw1.45.301.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]