SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7FCW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FCW2
Domain Number 1 Region: 3-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-54
Family Capz beta-1 subunit 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7FCW2
Sequence length 292
Comment (tr|W7FCW2|W7FCW2_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR77487.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_01064 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNNDKMEAALNICNTLPGHVFDDTIKMLSRIDQSITNNILINKEGSIKINYDKEENKYYL
GNMFNKEKDSYRSPYTNIYFPEHYINSYVPPEHLRTLEILYNKIFDRYRKAYYMNGLSSV
YLWPNPIEDGFVACFLIKKKEIFDKETNIKWEATHLIQVNITNLNVHYQISCTINFEIKK
NDNLLLSGNINKALENSKKVTDLYLIKDQYFHMENMGYLIECMENSLRKSIEYIYILKIQ
DMLNSIKYYNFTNHLTYNNTNKNISNISNSLIFSRENIQKELQTKIKQVRKK
Download sequence
Identical sequences A0A024VBN8 A0A024VT78 A0A024WDN2 A0A024WWC2 A0A024XE89 A0A0L1I5J4 A0A0L7K6H0 Q8I3T2 W4INM3 W4IVS7 W7FCW2 W7GAV7 W7JTF7 W7K8Y0
PFHG_00238T0 gi|124506271|ref|XP_001351733.1| gi|23504662|emb|CAD51540.1| 5833.PFE0880c-1 XP_001351733.1.26446 PFE0880c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]