SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7JGI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JGI0
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-19
Family Capz alpha-1 subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7JGI0
Sequence length 125
Comment (tr|W7JGI0|W7JGI0_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC78027.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_01285 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNNMLNEKKNFIRHVLMNSPPGKLYDLVKDINILLGSSVSIQKILEEVLKDYNEKNYNFI
LTDKNEYVITCKKFKVNHLYFIPKLKALNILYKGIKKYIGAILSRINNIIFFHIKYFLKT
KNVSH
Download sequence
Identical sequences W7JGI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]