SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7LHJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7LHJ0
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.28e-86
Family Capz beta-1 subunit 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7LHJ0
Sequence length 282
Comment (tr|W7LHJ0|W7LHJ0_GIBM7) F-actin-capping protein subunit beta {ECO:0000313|EMBL:EWG37971.1} KW=Complete proteome; Reference proteome OX=334819 OS=stalk rot fungus) (Fusarium verticillioides). GN=FVEG_01355 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAF
DVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTH
YKLTSTVILTLSTSGGNLGEMDLSGNMTRQVEQDLPVDNDDSHIANVGRLVEDMELKMRN
LLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRR
Download sequence
Identical sequences W7LHJ0
FVEG_01355T0 XP_018744162.1.41959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]