SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7U690 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7U690
Domain Number 1 Region: 8-294
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.19e-51
Family Capz beta-1 subunit 0.00000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7U690
Sequence length 354
Comment (tr|W7U690|W7U690_9STRA) F-actin-capping protein subunit beta {ECO:0000313|EMBL:EWM28164.1} KW=Complete proteome; Reference proteome OX=72520 OS=Nannochloropsis gaditana. GN=Naga_100004g104 OC=Monodopsidaceae; Nannochloropsis.
Sequence
MRDATASSQEQLRACLNLMRRLPPYKQQKNLQELQLLVPSIVGEELLQRVDVPLEEGIDM
KTNQPYLLCAFNREGSSHRSPWSNLYFPPAPSPSSLFYPSHYLRSLEVKANAAFQIYREL
YYDGQGVSSVYLWELSDEDADISETAGAATTSGSTASPRVGFAGCFAIKKGVLGDRSRRH
GTWDATHVVEVQPLCSAVGRADILAHYKLTSTIQVSLFASSDESEDVCAACVITKFVEAT
HPVVESTGGHISNVGRMIEDLEIKLRGDLGALYLQRTCDIVEKVRRSSATTKSKGGGVYG
ENSAEGTRARQRPAEVLSVGQASFSSEHQKSLFAAIARRNAERESNHKDYIYEA
Download sequence
Identical sequences W7U690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]