SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7WX24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W7WX24
Domain Number - Region: 97-182
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0191
Family Capz beta-1 subunit 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7WX24
Sequence length 202
Comment (tr|W7WX24|W7WX24_TETTS) Uncharacterized protein {ECO:0000313|EMBL:EWS71345.1} KW=Complete proteome; Reference proteome OX=312017 OS=Tetrahymena thermophila (strain SB210). GN=TTHERM_000670219 OC=Tetrahymena.
Sequence
MKIQIDMKKEQIIKQLIFQLKYLFFILIKRLSSKKSKSNYTSKKKKKSKRNQMKLEKKLK
ICSKDFQQKQNIHNYLFCQENLQNGHQRARIINRRQKLTNRFTKEINCRYEENQKERVLW
LNSNHFIIIRDIQSNILKNQNLYYLSKLIQQIIKISKKLKIFQKIYFKLNSCFFVVAFNT
KNYSKSFQILIFLKKIIFGANK
Download sequence
Identical sequences W7WX24
XP_012656119.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]