SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7X8T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7X8T2
Domain Number 1 Region: 20-294
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.29e-47
Family Capz alpha-1 subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7X8T2
Sequence length 296
Comment (tr|W7X8T2|W7X8T2_TETTS) F-actin capping protein alpha subunit {ECO:0000313|EMBL:EWS75780.1} KW=Complete proteome; Reference proteome OX=312017 OS=Tetrahymena thermophila (strain SB210). GN=TTHERM_000113219 OC=Tetrahymena.
Sequence
MADDYIQYDQQEQPQVVLDENKKTIMEYIIKNAPYGEINDVIADLKKLVDDYHLYESYVD
SLLIKHAQDHFAIVRDHPLQSTFLLTPLNYIEQEDCYLDQQHNLKVFVDHKTLKVTRTEE
VEIASNPVLGQYRGFIEKGIQEYLKNYYSGTEFGQLVYLDWDEENFTIYIAITCKNLKLN
SFHGGEWISDWKIDMKSFEGKVRINSHFFEGGNVMLKETKKFTEEVLFTGSQIENESQKI
VKQIINLEQSVQTSLESMYERMSDQFFKNMRRILPVTNMKMSWDASVHKLIANLKK
Download sequence
Identical sequences W7X8T2
XP_012651702.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]