SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W7YQU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W7YQU9
Domain Number - Region: 10-113
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz beta-1 subunit 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7YQU9
Sequence length 193
Comment (tr|W7YQU9|W7YQU9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:GAF04809.1} KW=Complete proteome; Reference proteome OX=869213 OS=Saccharicrinis fermentans DSM 9555 = JCM 21142. GN=JCM21142_93527 OC=Marinilabiliaceae; Saccharicrinis.
Sequence
MEFYNVELSKDIKSLCVEDFDINIWYDANRIKNILKCLFFNNDTIFFSFRREEDLTSDKE
LERLRISIIETFNKYGEYVFLKKLDEARFDSVARIDVSDFTFEFMFDIWKYFYSCTFFIP
TEGFSFSDYISFQKKIKFQDKGGEKLLSKRYSDFGCIKGLGGDSLIVSYRKDFQLPDLKK
AASETPDINQVFK
Download sequence
Identical sequences W7YQU9
WP_027473264.1.27926 WP_027473264.1.75972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]