SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7YUT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W7YUT6
Domain Number - Region: 53-114
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 0.0575
Family Arp2/3 complex 16 kDa subunit ARPC5 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7YUT6
Sequence length 218
Comment (tr|W7YUT6|W7YUT6_9BACI) Uncharacterized protein {ECO:0000313|EMBL:GAF14780.1} KW=Complete proteome; Reference proteome OX=1460639 OS=Bacillus sp. JCM 19045. GN=JCM19045_4111 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MAKATTVIKKMPVDPNKIREKDLKMIEDALIDNKDVIINVLSLLQKANKTEAFNMAHSAF
DQSEPLMNQLVKTLDDPHITQALKNVLVISQALGSIKLADLEPMLFKLNSALHQVAEYEH
GQTSGGYTSLLRSVRDPETIEGLNTMMAFVKGFGMDQSNREENQSQFERSTLAGVDYQET
TRVKCKHNHPAQPHTKWYVVAAGALAFALPLILNRKSS
Download sequence
Identical sequences W7YUT6 W7ZU30
WP_035421215.1.29416 WP_035421215.1.5296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]