SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W8BEJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W8BEJ3
Domain Number 1 Region: 3-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-95
Family Capz beta-1 subunit 0.00000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W8BEJ3
Sequence length 276
Comment (tr|W8BEJ3|W8BEJ3_CERCA) F-actin-capping protein subunit beta {ECO:0000313|EMBL:JAB99720.1} OX=7213 OS=Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata). GN=CAPZB OC=Tephritoidea; Tephritidae; Ceratitis; Ceratitis.
Sequence
MSDVQMDSALDLMRRLPPQQIEKNLIDLIDLAPELCEDLLSSVDQPLKIAKDKEHNKDYL
LCDYNRDGDSYRSPWSNTYYPPLEDGQMPSDRLRKLEIDANYAFDQYREMYYEGGVSSVY
LWDLEHGFAAVVLIKKAGDGNKKIRGCWDSIHVVEVQEKPTGRTAHYKLTSTAMLWLQTN
KQGSGTMNLGGSLTRQTEQDTNVSESSPHIVNIGKMVEEMENKIRNTLNEIYFGKTKDII
NGLRSVQPLADQRQEVAMKQDLAAAILKRNVKPESN
Download sequence
Identical sequences W8BEJ3
XP_004531272.1.71379 XP_004531273.1.71379 XP_020716054.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]