SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W9CHU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W9CHU9
Domain Number 1 Region: 5-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.55e-81
Family Capz beta-1 subunit 0.0000000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W9CHU9
Sequence length 284
Comment (tr|W9CHU9|W9CHU9_9HELO) F-actin capping protein beta subunit {ECO:0000313|EMBL:ESZ95553.1} KW=Complete proteome; Reference proteome OX=1432307 OS=Sclerotinia borealis F-4128. GN=SBOR_4033 OC=Helotiales; Sclerotiniaceae; Sclerotinia.
Sequence
MAEVDQFDSALDLLRRLNPKHTTAHLNSLIDLVPSLTEDLLSSVDQPLTISRCRKTGRDY
LLCDYNRDGDSYRSPWSGEFETPVGGTTPGGIDDQGNNDGAGEGAVPSERVRKMEVRANE
AFDVYRELYYEGGVSSVYFWNLDDGFAGVVLLKKVSPTSSGSAGSWDSIHVFEAVDRART
AHYKLTSTVILSLSTSGNELGEMDLSGNMTRQIEADLPIQDDADHIANIGRLVEDMELKM
RNLLQEVYFGKAKDVVGDLRSLGSLSEGAKERKVRGEMLDAMKR
Download sequence
Identical sequences W9CHU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]