SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W9CQM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W9CQM5
Domain Number - Region: 12-59
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz alpha-1 subunit 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W9CQM5
Sequence length 89
Comment (tr|W9CQM5|W9CQM5_9HELO) Uncharacterized protein {ECO:0000313|EMBL:ESZ98151.1} KW=Complete proteome; Reference proteome OX=1432307 OS=Sclerotinia borealis F-4128. GN=SBOR_1454 OC=Helotiales; Sclerotiniaceae; Sclerotinia.
Sequence
MKSTTYSQSYSYNVDVIITVDIDTNTVNVIVDVDIHTEANLNANFNFNFNVNVNANVNAD
MISNATQDRQDSRKWLHDATYLDKPPHQR
Download sequence
Identical sequences W9CQM5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]