SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W9QHX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W9QHX9
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-68
Family Capz beta-1 subunit 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W9QHX9
Sequence length 262
Comment (tr|W9QHX9|W9QHX9_9ROSA) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:EXB37799.1} KW=Complete proteome; Reference proteome OX=981085 OS=Morus notabilis. GN=L484_002734 OC=Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus.
Sequence
MEAAMGLMRRMPPKHIETALSALLTLLPQHSSDLLSQVDQPLQVLCDVDSGKEFILCEYN
RDADSYRSPWSNKYHPQLEDGSLPSPDLRKLEVEANDIFAIYRDQYYEGGISSVYMWEDD
NEGFAACFLIKKDGSKTGHGRRGYLQEGAWDAIHVIEVGPVEEGTAHYRLTSTVMLSLTT
NNDTSGMFNLSGSIRREMNMDLPIQEGHICNMGRMIEEMESKLRNSLDQNQEAVCFGKVE
DNCSFLKNTLLYFDMVLKFASR
Download sequence
Identical sequences W9QHX9
XP_010089433.1.32101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]