SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W9RYV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W9RYV7
Domain Number 1 Region: 12-37
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000034
Family Capz alpha-1 subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W9RYV7
Sequence length 161
Comment (tr|W9RYV7|W9RYV7_9ROSA) Uncharacterized protein {ECO:0000313|EMBL:EXC17984.1} KW=Complete proteome; Reference proteome OX=981085 OS=Morus notabilis. GN=L484_002877 OC=Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus.
Sequence
MNGALDWPSSDVEDLRRKLPVTRTLFPWHNTMQFSLTRDISKELGIGNTFGVQSWTWQQD
GGLVIRPNSQRPARDGKMRASSCCGRSNSGLEGRFNVRTIAAAPPKSLSSAKPLNSTFLH
DHWISTSCRHDPNLSSQARAAVISVVPPVATERLMKCRQRN
Download sequence
Identical sequences W9RYV7
XP_010108152.1.32101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]