SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W9YUM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W9YUM5
Domain Number 1 Region: 3-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-73
Family Capz alpha-1 subunit 0.00000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W9YUM5
Sequence length 283
Comment (tr|W9YUM5|W9YUM5_9EURO) Uncharacterized protein {ECO:0000313|EMBL:EXJ92951.1} KW=Complete proteome; Reference proteome OX=1182542 OS=Capronia epimyces CBS 606.96. GN=A1O3_01507 OC=Chaetothyriomycetidae; Chaetothyriales; Herpotrichiellaceae; Capronia.
Sequence
MGSTVDIASAFVQGAPPGELQEVVKDIRGLTADDDPALIAKLKPAFERYNEEQLTSVKLP
GSNDYVLISKYNKLPSSSSSSRYYDTQSSTSFEFDHTTSKASATQSYTHETQHTALIQSI
LKSLAGHFADHYPPTTAAAYTVCATPDDDKHIAVLVSTTKASPKNFLSGRWRSVFLYDPS
AGTLSGETKIDVHYYEDGNVALTTGKKFDAVSVGGAADGAAIVRKIAVIENQYQEEVNRT
IVGMNETSFRHLRRQLPVTRQKVEWEKVKGYSLGSDLKGEAKR
Download sequence
Identical sequences W9YUM5
XP_007729841.1.25706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]