SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X0K7A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X0K7A1
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.2e-84
Family Capz alpha-1 subunit 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X0K7A1
Sequence length 273
Comment (tr|X0K7A1|X0K7A1_FUSOX) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EXM09313.1} KW=Complete proteome; Reference proteome OX=1089451 OS=Fusarium oxysporum f. sp. cubense tropical race 4 54006. GN=FOIG_02182 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSDLETVSAFVEGAPPGELADVIADIKSLTLETSPDIISNLGPAFEKYNEEQFVTVKLPG
SSQPVIISSHNSLGDGRYYDVESSSSFAFDHTTQKASAVQSHVLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYILDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTISSVNGASIVREISTTERKYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGGGSSRR
Download sequence
Identical sequences A0A0D2XGY3 A0A2H3H6E9 W9KBA4 X0A0C1 X0K7A1
XP_018237121.1.49799 FOXG_03179T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]