SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X0LPU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X0LPU5
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-86
Family Capz beta-1 subunit 0.0000000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X0LPU5
Sequence length 282
Comment (tr|X0LPU5|X0LPU5_FUSOX) F-actin-capping protein subunit beta {ECO:0000313|EMBL:EXM10605.1} KW=Complete proteome; Reference proteome OX=1089451 OS=Fusarium oxysporum f. sp. cubense tropical race 4 54006. GN=FOIG_00633 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAF
DVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTH
YKLTSTVILTLSTAGGNLGEMDLSGNMTRQVEQDLPVDNDDSHIANVGRLVEDMELKMRN
LLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRR
Download sequence
Identical sequences A0A0I9XWY2 A0A1L7S9W5 A0A1L7V2N2 A0A2K0VY27 N1RD95 S0DIM0 X0LPU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]