SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X0VEH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X0VEH3
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily CPE0013-like 0.0000000000000366
Family CPE0013-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X0VEH3
Sequence length 67
Comment (tr|X0VEH3|X0VEH3_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAG16735.1} OX=412755 OS=marine sediment metagenome. GN=S01H1_54373 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
NGDFSLVSVKTPVSIPKKYLKKIGGITRQLKVKAPVTIGQVVAFNLLSENIDLIATRKIE
KKKSLSS
Download sequence
Identical sequences X0VEH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]