SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X0XFX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X0XFX5
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz beta-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X0XFX5
Sequence length 132
Comment (tr|X0XFX5|X0XFX5_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAG34332.1} OX=412755 OS=marine sediment metagenome. GN=S01H1_74120 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MGKFDAKKKIQDIQELKKEGVIRENSVYHYMNEDDIQRFWKKRARDGTKIHNLIENYFRY
KQLFTNKVHPLYKDFEKFLRYYDKIRKDGWKLFVPEFKIYCDDPFIGGMIDLLTYRKNES
TGEYEYMLVDWK
Download sequence
Identical sequences X0XFX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]