SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X1DH63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X1DH63
Domain Number - Region: 74-200
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz alpha-1 subunit 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X1DH63
Sequence length 317
Comment (tr|X1DH63|X1DH63_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAH19492.1} OX=412755 OS=marine sediment metagenome. GN=S03H2_06682 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
QQNSEVIEQKLKALPRGVILGDETYLGSRGNSDTEIVFINNEYETLSIGLADEGDLKTSI
LEAFHKIPEACRERLKVLITDGEPSYKSIAKIFGSKVIHVAQLHTQKQRGEVIISKYEKL
GPHFLHYKIYTHWKAFYRNKYELAFKWEIKFIKGKIQKKRGRPLKADTSETKNERWRQKL
EKYQSDSFQKEGTAKIFVNFETNKLSIRAGAKKWMNRMLSPIFKIFKGKHITTNKIESKH
SQVKRSGAGRKQRDKEYGHKLYALHTFLVESGHIPFTNLAGRSLYSYLIKSNKKKKIGYR
TLENDRIFVQTVLSAYE
Download sequence
Identical sequences X1DH63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]