SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1QIZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X1QIZ6
Domain Number - Region: 4-139
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 0.0615
Family Adenylylcyclase toxin (the edema factor) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X1QIZ6
Sequence length 168
Comment (tr|X1QIZ6|X1QIZ6_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAI43244.1} OX=412755 OS=marine sediment metagenome. GN=S06H3_44890 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MEKNKTFKVGDKIIHFDQVYRIFKIRKRNKDKIIFFKRYFKTKENRKLVFSIPISSIDET
KVRKPISKKKLRDLFKALSQKPEAKIAINTVKAKELLGSNSLDKIIEILKQFWQEKKTDP
DHFNKSKENVFKLAIKKLSEEIALVNDISLAKARKKIKNALKKSKNAK
Download sequence
Identical sequences X1QIZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]