SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X1QTK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X1QTK9
Domain Number - Region: 2-41
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0235
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X1QTK9
Sequence length 82
Comment (tr|X1QTK9|X1QTK9_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAI71917.1} OX=412755 OS=marine sediment metagenome. GN=S12H4_07016 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MNFEEGFSDVFWWLYDIKGIWITLKIIKNNFYNPNDIIPNISNDYIKDQLAIEIIMKFCK
LAEDLGALLMSKDNDKVKFTSN
Download sequence
Identical sequences X1QTK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]