SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1VNQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X1VNQ7
Domain Number - Region: 42-99
Classification Level Classification E-value
Superfamily IpaD-like 0.0259
Family IpaD-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X1VNQ7
Sequence length 124
Comment (tr|X1VNQ7|X1VNQ7_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAJ21492.1} OX=412755 OS=marine sediment metagenome. GN=S12H4_60242 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MALAKSRTRINIGGGYLEVSIDSGANWLPIGYTENSKINDGTATEEFHNEMGEFLGLGEG
NELVTFETLMLQSTLDELNFWLTYKGKVVDARYQAWMPGTSKWQLFSLDEVIVDPNLELN
FGTS
Download sequence
Identical sequences X1VNQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]