SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1X0C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X1X0C7
Domain Number - Region: 38-80
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 0.0798
Family Hypothetical protein YhaI 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X1X0C7
Sequence length 187
Comment (tr|X1X0C7|X1X0C7_ACYPI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:ACYPI071713-PA} KW=Complete proteome; Reference proteome OX=7029 OS=Acyrthosiphon pisum (Pea aphid). GN= OC=Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
Sequence
MLGYNNLINTIIEKRKNVFNLSWVIHHRLAGTAEAMDMKFSVNVLITMYRRTKKGFFKIC
ILKRCSNRDLEELVQLKSQEIYYFGCLAFNTSGSKSVDIFLACSLFFIKMLMKRTDGDVG
LEIVGELASTALHESLRRLTWKVVWSVSERRGCKGAWDTGPSHWDNWDQLGHGVHGAKCY
GNNYYIL
Download sequence
Identical sequences X1X0C7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]