SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X4ZDH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X4ZDH0
Domain Number 1 Region: 48-119
Classification Level Classification E-value
Superfamily CPE0013-like 4.32e-21
Family CPE0013-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X4ZDH0
Sequence length 136
Comment (tr|X4ZDH0|X4ZDH0_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AHV95542.1} KW=Complete proteome; Reference proteome OX=1268072 OS=Paenibacillus sabinae T27. GN=PSAB_03030 OC=Paenibacillus.
Sequence
MMKQSTLTCIVCPKECALDVYSLDRVVTYISGYSCERGKRYAHDETLCPSRIVTTTVSIE
GGVCKRLPVRSSGPLPKERMGEWMRLVKELRVKAPVRAGEVLIAGILGTGTDVISSKSVA
LDQQSSVAHDISGAGC
Download sequence
Identical sequences X4ZDH0
WP_051529707.1.55596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]