SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X4ZHW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X4ZHW9
Domain Number - Region: 39-106
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz alpha-1 subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X4ZHW9
Sequence length 150
Comment (tr|X4ZHW9|X4ZHW9_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AHV96300.1} KW=Complete proteome; Reference proteome OX=1268072 OS=Paenibacillus sabinae T27. GN=PSAB_06830 OC=Paenibacillus.
Sequence
MIRLETKDIVSIAKKQIANIFKMEPLELRFVDDFQGEKSLLTDDKLHLTNRHYWAKVMDC
IFENQVRPVLMCEVLYFLRNEYLESEIDLKFSFDFSEGSLVDVDAVAEVNFNDNPDLDKN
EIAELIDFALALQDKQWFEELSQKYKELSA
Download sequence
Identical sequences X4ZHW9
WP_025333861.1.55596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]