SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X5JGY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X5JGY4
Domain Number - Region: 34-61
Classification Level Classification E-value
Superfamily Proteasome activator 0.0353
Family Proteasome activator 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X5JGY4
Sequence length 62
Comment (tr|X5JGY4|X5JGY4_9NOST) Uncharacterized protein {ECO:0000313|EMBL:CDN11074.1} KW=Complete proteome; Reference proteome OX=1164990 OS=Richelia intracellularis. GN=RintRC_0096 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Richelia.
Sequence
MFWSQARELFEQIVSWLDSDNICGLEHSQIESKLVENGYELLRRFLPVLIPLIAEGDNMP
VE
Download sequence
Identical sequences X5JGY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]