SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X5KA87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X5KA87
Domain Number 1 Region: 164-290
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000115
Family Glutathione peroxidase-like 0.011
Further Details:      
 
Weak hits

Sequence:  X5KA87
Domain Number - Region: 69-149
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz beta-1 subunit 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X5KA87
Sequence length 301
Comment (tr|X5KA87|X5KA87_9FLAO) DUF5106 domain-containing protein {ECO:0000313|EMBL:OPB56987.1} KW=Complete proteome OX=1117645 OS=Elizabethkingia anophelis. GN=BAY10_08130 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MKLKLNSFSVFYCSCVLLFSCTKKEEQKTTQQQEIVGNEAESSTDKVTRSIADYWDHYNF
ADTNAIKDPAQAEQALVDFIALFPDANQKQISQSINAMFEKASVNKEVFSFFKDGYEKYL
YDPNSPLHNDVYFLPVLEYLVNTKHLNDTEKIRYRMLLKLVNKNMPGSVATDFEFIDSSG
KDQNLHQIKAPEKLLVFYDPECSHCAEAIKQMSQDVRINALINQEKLKVVAVSPVEDINK
WKAYQANIPTKWINGFDKKGDLKQKELYDIKAFPTIYLLDEKNEVVLKDTSLEQVLSLLK
I
Download sequence
Identical sequences A0A290MVX2 X5KA87
WP_009086239.1.12423 WP_009086239.1.14670 WP_009086239.1.20431 WP_009086239.1.23011 WP_009086239.1.24974 WP_009086239.1.33535 WP_009086239.1.34046 WP_009086239.1.37971 WP_009086239.1.44679 WP_009086239.1.59082 WP_009086239.1.62611 WP_009086239.1.67546 WP_009086239.1.67622 WP_009086239.1.68736 WP_009086239.1.70566 WP_009086239.1.74790 WP_009086239.1.80499 WP_009086239.1.8955 WP_009086239.1.93686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]