SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X5KTU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X5KTU9
Domain Number 1 Region: 266-362
Classification Level Classification E-value
Superfamily Acid proteases 0.0000962
Family Retroviral protease (retropepsin) 0.055
Further Details:      
 
Weak hits

Sequence:  X5KTU9
Domain Number - Region: 72-194
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X5KTU9
Sequence length 381
Comment (tr|X5KTU9|X5KTU9_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CDN75024.1} KW=Complete proteome OX=1117645 OS=Elizabethkingia anophelis. GN=E18064_370030 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MKHFFSLSLLFVMVLCFSQRKVTIVKANFNNAKIYEEDNRVSGWGINPKVNPDTHTTGKI
TKRKKVVFKTDIDSIIVNLKPGEKKDFIVLLNGKDSCYTRIQGPEVKKFSRDKPEIHDTI
PFIVNKYNTNLVKTFFNHKDSLTFNFDTGATEMSVTRDALKNKIKSNPKLYNTLYDIQIG
RRTYKSEIYDHEMVGQEADGLLGWNIFDGLVVELNYDTEKMIVHSKMPKDIMKDKDYSKF
KIWYFNNKPFIECDMSENGVWYKEWFLFDLGYQRSVMLDNDLLKDKKFPVDNMKIIKKTS
LRGVSGKEIPVITANLQKIKIGKAELKNIPAQLLTANKPMGNAKIHILGNDILKRFNTVL
DFQNDIIYLKPNSLSGKELLN
Download sequence
Identical sequences X5KTU9
WP_035590485.1.44513 WP_035590485.1.70566 WP_035590485.1.80499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]