SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X6P1V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X6P1V5
Domain Number - Region: 61-114
Classification Level Classification E-value
Superfamily Fzo-like conserved region 0.000837
Family Fzo-like conserved region 0.0098
Further Details:      
 
Domain Number - Region: 134-176
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00288
Family RILP dimerisation region 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X6P1V5
Sequence length 275
Comment (tr|X6P1V5|X6P1V5_RETFI) Uncharacterized protein {ECO:0000313|EMBL:ETO31537.1} KW=Complete proteome; Reference proteome OX=46433 OS=Reticulomyxa filosa. GN=RFI_05583 OC=Reticulomyxa.
Sequence
MNALDNFDKNKQATRYLTRIKTRIKNRSEKNMKTNANINTNINNRNSRSSCIEEENELLG
KIIKAIQETNTKLQNENNQLRNEIMILKKGCDQENELKQKINILENQINYYKQDIFRFEM
DKLELLEENRYFVNELRNVCNERELLQTQLNTLEQKLLQFRFNKMQLKINKQIIFEEKDN
EDKCNSPLINNSFSQIIINVKNMENEMNNITLYKTIIHQLLKEMENLKNQIQIKHCMYEQ
SQRQYQLILSQYQSLSKKLFIYYNYLLFIIIYNIK
Download sequence
Identical sequences X6P1V5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]