SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X6Q5F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X6Q5F2
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.022
Family Capz beta-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X6Q5F2
Sequence length 69
Comment (tr|X6Q5F2|X6Q5F2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ETT03593.1} KW=Complete proteome OX=1256987 OS=Providencia alcalifaciens F90-2004. GN=HMPREF1562_3923 OC=Morganellaceae; Providencia.
Sequence
MEDELIQVPKDLLEELASEYQAKISWFIEAYKGYYNVVGSRYNRDYNYYVDNFNAAADLL
GWDKMEKIE
Download sequence
Identical sequences X6Q5F2
WP_036983525.1.12448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]