SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X8H5I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X8H5I9
Domain Number - Region: 69-146
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X8H5I9
Sequence length 443
Comment (tr|X8H5I9|X8H5I9_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EUB21123.1} KW=Complete proteome OX=936591 OS=Veillonella sp. ICM51a. GN=HMPREF1504_2022 OC=Veillonella.
Sequence
MQKLPLLVGAFIMSTMLSPVKAINVNIPDADAKIPKDAYINYQASTPAIEQDVANYVETL
KSTDKANGISRNELAYAKEASIYRGEHYHNTVISVHNRYSQIRLSFPVAGIKSEYNIGRY
KNPDRTIEDYRVITDNGSLNLEIDYADYKDQDWRNTKIAYEKLTDKDVRKFLQDKAKKSP
EKHISDIKATVFSYPTVSYSTWDSMKMPYLKNGQKTTMTVDTINFKHMGFAIRYPLYHAG
IAYFDNKPVLNKVPTDNLLANYVLPSVKNLNELNQYSRIENLNGIQYRVPKDALFEGESK
EDYQDIRYYKKGSITFFVSTINLTNNPYTRNLIIDGHYNFSRNLHSFWNIYRYHPTPEYI
NYAVVWNNNIPGLSIHSYEPYSDIQILNFESYDGTYGFIYTIFYPNFLSADEVQKLRNMI
EFFDSTNNPEFKLQEHVVFPENR
Download sequence
Identical sequences X8H5I9
WP_038125103.1.40366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]