SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X8JQ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X8JQ18
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-85
Family Capz beta-1 subunit 0.0000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X8JQ18
Sequence length 269
Comment (tr|X8JQ18|X8JQ18_9HOMO) F-actin capping protein beta subunit {ECO:0000313|EMBL:EUC65108.1} KW=Complete proteome OX=1086054 OS=Rhizoctonia solani AG-3 Rhs1AP. GN=RSOL_497690 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MSEDVLDSMLDLMRRLPPTRVEENVALLCEMCPDYADDLLGSVDQPLQVRHDKSVGKEYL
ICDYNRDGDSYRSPWSNEYDPPLEEGTQPSVKLRKLEIAANEAFDTYREMYFEGGVSSVF
LWDLDDGGFAGVVLLKKTLPAPTPNEPSGSWDSIHVFEANERGRTAHYKLTSTVMLQLKI
KGEASGEVDLSGSMTRQQEEDRPLPDPAAHIANTGRMVEEMELKMRNLLQEVYFGKTRDV
VFDLRSVESLDKQRKQRELQKELVGLLKR
Download sequence
Identical sequences A0A074RQY5 X8JQ18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]